Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P26129

Expression Region

1-97

Origin

Influenza A virus (strain A/Leningrad/134/1957 H2N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCNYRFFKHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogranin A (LK2H10 + PHE5), CF640R conjugate, 0.1mg/mL
BNC400698-500 1x 500 µL

Chromogranin A (LK2H10 + PHE5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PHGDH (NM_006623) Human Recombinant Protein
TP303949 20 µg

PHGDH (NM_006623) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS701593 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
TRITC Conjugated Rabbit Anti-PHA-L Antibody
RAL-1801-2 2 mL

TRITC Conjugated Rabbit Anti-PHA-L Antibody

Sign In for Pricing
View Details
Tylosin-d3
TRC-T947652-1MG 1 mg

Tylosin-d3

Sign In for Pricing
View Details
Recombinant CDX2 Antibody
RC-16828-01 50 μL

Recombinant CDX2 Antibody

Sign In for Pricing
View Details