Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P26129

Expression Region

1-97

Origin

Influenza A virus (strain A/Leningrad/134/1957 H2N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCNYRFFKHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Skin
CS805100 5x 5 µm

Tissue FFPE Sections, Skin

Sign In for Pricing
View Details
VRK1 (Center) Rabbit Polyclonal Antibody
AP14050PU-N 400 µL

VRK1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD11a (Cris-3), CF568 conjugate, 0.1mg/mL
BNC680151-500 1x 500 µL

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF583 Mouse Monoclonal Antibody [Clone ID: OTI3E2]
CF810557 100 µg

ZNF583 Mouse Monoclonal Antibody [Clone ID: OTI3E2]

Sign In for Pricing
View Details
Mouse TIMP-1 Antibody Pair Set
E-KAB-0287 50 µL & 100 µg

Mouse TIMP-1 Antibody Pair Set

Sign In for Pricing
View Details
o-Dianisidine
TRC-D416498-250MG 250 mg

o-Dianisidine

Sign In for Pricing
View Details