Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P26129

Expression Region

1-97

Origin

Influenza A virus (strain A/Leningrad/134/1957 H2N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCNYRFFKHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E2F6 Polyclonal Antibody
E-AB-10295-01 20 µL

E2F6 Polyclonal Antibody

Sign In for Pricing
View Details
E2F6 Polyclonal Antibody
E-AB-10295-02 60 µL

E2F6 Polyclonal Antibody

Sign In for Pricing
View Details
E2F6 Polyclonal Antibody
E-AB-10295-03 120 µL

E2F6 Polyclonal Antibody

Sign In for Pricing
View Details
E2F6 Polyclonal Antibody
E-AB-10295-04 200 µL

E2F6 Polyclonal Antibody

Sign In for Pricing
View Details
Human AKR7L activation kit by CRISPRa
GA116720 1 Kit

Human AKR7L activation kit by CRISPRa

Sign In for Pricing
View Details
ZNF454 Mouse Monoclonal Antibody [Clone ID: OTI2G4]
CF810948 100 µg

ZNF454 Mouse Monoclonal Antibody [Clone ID: OTI2G4]

Sign In for Pricing
View Details