Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P36348

Expression Region

1-97

Origin

Influenza A virus (strain A/Chicken/Brescia/1902 H7N7)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECRCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BBS5 (Bardet-Biedl Syndrome 5 Protein, BBS5) (MaxLight 650) discontinued
302288-ML650 100 µL

BBS5 (Bardet-Biedl Syndrome 5 Protein, BBS5) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Lentiviral human ELAVL3 sgRNA gene knockout kit - Lentiviral human ELAVL3 sgRNA gene knockout kit (100)
GTR15370834 1 Vial

Lentiviral human ELAVL3 sgRNA gene knockout kit - Lentiviral human ELAVL3 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Gna13 Mouse siRNA Oligo Duplex (Locus ID 14674)
SR412738 1 Kit

Gna13 Mouse siRNA Oligo Duplex (Locus ID 14674)

Sign In for Pricing
View Details
CCRL2 Protein Lysate (Human) with C-Ha Tag
15437033 100 µg

CCRL2 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
B4GALT4 Rabbit pAb (APR29721N)
APR29721N-01 50 µL

B4GALT4 Rabbit pAb (APR29721N)

Sign In for Pricing
View Details
B4GALT4 Rabbit pAb (APR29721N)
APR29721N-02 100 µL

B4GALT4 Rabbit pAb (APR29721N)

Sign In for Pricing
View Details