Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P36348

Expression Region

1-97

Origin

Influenza A virus (strain A/Chicken/Brescia/1902 H7N7)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECRCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEOX2 (Mesenchyme Homeobox 2, GAX, MOX2) (MaxLight 650)
MBS6228723-01 0.1 mL

MEOX2 (Mesenchyme Homeobox 2, GAX, MOX2) (MaxLight 650)

Sign In for Pricing
View Details
MEOX2 (Mesenchyme Homeobox 2, GAX, MOX2) (MaxLight 650)
MBS6228723-02 5x 0.1 mL

MEOX2 (Mesenchyme Homeobox 2, GAX, MOX2) (MaxLight 650)

Sign In for Pricing
View Details
Azide rA 15 umol scale
27-6765A-15 1 Each

Azide rA 15 umol scale

Sign In for Pricing
View Details
DDIT4L CRISPRa sgRNA lentivector (set of three targets)(Human)
17780121 3x 1.0µg DNA

DDIT4L CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
NUDCD3 (NM_015332) Human Tagged Lenti ORF Clone
RC206181L1 10 µg

NUDCD3 (NM_015332) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Tef siRNA Oligos set (Mouse)
46479174 3x 5 nmol

Tef siRNA Oligos set (Mouse)

Sign In for Pricing
View Details