Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P35938

Expression Region

1-97

Origin

Influenza A virus (strain A/USSR/90/1977 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRLFKHGLK RGPSTEGVPESMREEYRKEQQNAVDADDSHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLIC1 Polyclonal Antibody
RD78261A-01 20 µL

CLIC1 Polyclonal Antibody

Sign In for Pricing
View Details
CLIC1 Polyclonal Antibody
RD78261A-02 60 μL

CLIC1 Polyclonal Antibody

Sign In for Pricing
View Details
CLIC1 Polyclonal Antibody
RD78261A-03 120 μL

CLIC1 Polyclonal Antibody

Sign In for Pricing
View Details
CLIC1 Polyclonal Antibody
RD78261A-04 200 µL

CLIC1 Polyclonal Antibody

Sign In for Pricing
View Details
SCARB1 Monoclonal Antibody
E10-32154 100 µg -100 µL

SCARB1 Monoclonal Antibody

Sign In for Pricing
View Details
Cdc2 (Cyclin-Dependent Kinase 1, Cell Division Control Protein 2 Homolog, Cell Division Protein Kinase 1, p34 Protein Kinase, CDK1, CDC2, CDC28A, CDKN1, P34CDC2) discontinued
221565-01 50 µL

Cdc2 (Cyclin-Dependent Kinase 1, Cell Division Control Protein 2 Homolog, Cell Division Protein Kinase 1, p34 Protein Kinase, CDK1, CDC2, CDC28A, CDKN1, P34CDC2) discontinued

Sign In for Pricing
View Details