Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P35938

Expression Region

1-97

Origin

Influenza A virus (strain A/USSR/90/1977 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRLFKHGLK RGPSTEGVPESMREEYRKEQQNAVDADDSHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm13276 ORF Vector (Mouse) (pORF)
21804014 1.0 µg DNA

Gm13276 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Oleyl myristate
HY-122531 1 Each

Oleyl myristate

Sign In for Pricing
View Details
LOC681931 3'UTR Luciferase Stable Cell Line
TU210823 1.0 mL

LOC681931 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain 8739/DSM 1576/Crooks) RECF Polyclonal Antibody
MBS7184390 Inquire

Rabbit anti-Escherichia coli (strain 8739/DSM 1576/Crooks) RECF Polyclonal Antibody

Sign In for Pricing
View Details
Npas2 sgRNA CRISPR Lentivector set (Mouse)
K3972601 3x 1.0 µg

Npas2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Nitric Oxide Synthase (NOS) Inhibitor HP-228 [Nle4-Acetyl, Gln5, D-Phe7, D-Trp9]-a-MSH (4-10) amide
MBS659228-01 1 mg

Nitric Oxide Synthase (NOS) Inhibitor HP-228 [Nle4-Acetyl, Gln5, D-Phe7, D-Trp9]-a-MSH (4-10) amide

Sign In for Pricing
View Details