Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P35938

Expression Region

1-97

Origin

Influenza A virus (strain A/USSR/90/1977 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRLFKHGLK RGPSTEGVPESMREEYRKEQQNAVDADDSHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM25 (Tripartite Motif-Containing 25, EFP, RNF147, Z147, ZNF147) (MaxLight 750) discontinued
252988-ML750 100 µL

TRIM25 (Tripartite Motif-Containing 25, EFP, RNF147, Z147, ZNF147) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR559157 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
Adamts19-set siRNA/shRNA/RNAi Lentivector (Rat)
11358096 4x 500 ng

Adamts19-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Ampicilline
ABDAMP10A Single Vial

Ampicilline

Sign In for Pricing
View Details
TMED6 (NM_144676) Human Recombinant Protein
TP305022M 100 µg

TMED6 (NM_144676) Human Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human ANKRD42 shRNA (UAS) - Lentiviral human ANKRD42 shRNA (UAS, GFP) plasmid
GTR15312001 1 Vial

Lentiviral human ANKRD42 shRNA (UAS) - Lentiviral human ANKRD42 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details