Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0097 (AF_0097)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0097 (AF_0097) spans the amino acid sequence from region 1-98.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0097

UniProt

O30139

Expression Region

1-98

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASYVFIRVSKIRKGYFPVLLAIGFAITFAEGFILFLVNFGAIPTNGPTIQLVPQIIMQN PNPLIRFYGTLILLCFLNTIVLSIFYATIAKLLPKFSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPY5R Antibody
8G412-AAT 50 µg

NPY5R Antibody

Sign In for Pricing
View Details
MED28 Mouse Monoclonal Antibody [Clone ID: OTI10C8]
CF810134 100 µg

MED28 Mouse Monoclonal Antibody [Clone ID: OTI10C8]

Sign In for Pricing
View Details
7-Benzoyloxindole
TRC-B208155-250MG 250 mg

7-Benzoyloxindole

Sign In for Pricing
View Details
Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3295), CF647 conjugate, 0.1mg/mL
BNC473295-500 1x 500 µL

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3295), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD6 (3F7B5), CF568 conjugate, 0.1mg/mL
BNC680428-500 1x 500 µL

CD6 (3F7B5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Tetranectin Antibody
RC-5063-01 50 μL

Recombinant Tetranectin Antibody

Sign In for Pricing
View Details