Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phoca hispida NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

This Recombinant Phoca hispida NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) spans the amino acid sequence from region 1-98.

Product Specifications

Product Name Alternative

NADH-ubiquinone oxidoreductase chain 4L, EC= 1.6.5.3, NADH dehydrogenase subunit 4L

UniProt

Q08GV9

Expression Region

1-98

Origin

Phoca hispida (Ringed seal) (Pusa hispida)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSMVYANIFLAFIMSLMGLLMYRSHLMSSLLCLEGMMLSLFVMMTVTILNNHFTLANMAP IILLVFAACEAALGLLLLVMVSNTYGTDYVQNLNLLQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF405S conjugate, 0.1mg/mL
BNC040175-100 1x 100 µL

CD46 (122.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL
BNC040149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL
BNC470225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF660R conjugate, 0.1mg/mL
BNC610164-500 1x 500 µL

CD28 (204.12), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), Biotin conjugate, 0.1mg/mL
BNCB0460-500 1x 500 µL

CD44 Standard (156-3C11), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), 0.2mg/mL
BNUB0305-500 1x 500 µL

CD95 (B-R18), 0.2mg/mL

Sign In for Pricing
View Details