Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Semnopithecus entellus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

This Recombinant Semnopithecus entellus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) spans the amino acid sequence from region 1-98.

Product Specifications

Product Name Alternative

NADH-ubiquinone oxidoreductase chain 4L, EC= 1.6.5.3, NADH dehydrogenase subunit 4L

UniProt

Q15GS3

Expression Region

1-98

Origin

Semnopithecus entellus (Hanuman langur) (Presbytis entellus)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPIIYMNIMLSFIISLLGMLIYRSHLMSSLLCLEGMMLSLFIMSTLMALNMHFPLANIVP VALLVFAACEAAVGLALLVSISNTYGLDYVHNLSLLQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
BNC400977-500 1x 500 µL

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF740 conjugate, 0.1mg/mL
BNC740012-100 1x 100 µL

Tyrosinase (T311), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL
BNC742853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF594 conjugate, 0.1mg/mL
BNC940676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3 + CC49), CF647 conjugate, 0.1mg/mL
BNC470738-500 1x 500 µL

TAG-72 / CA72.4 (B72.3 + CC49), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MMP9 (rMMP9/1769), CF640R conjugate, 0.1mg/mL
BNC402176-500 1x 500 µL

MMP9 (rMMP9/1769), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details