Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus PsbF-like protein (PMT9312_1176)

This Recombinant Prochlorococcus marinus PsbF-like protein (PMT9312_1176) spans the amino acid sequence from region 1-98.

Product Specifications

Product Name Alternative

PsbF-like protein

UniProt

Q31A60

Expression Region

1-98

Origin

Prochlorococcus marinus (strain MIT 9312)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFRVLLVISPIIFAWIFTVFWLGKWDVFRLTPFGLPKRGVAPFENYQVWGDSAVVPNTG RPSEGYPVFTVRTAAVNALGIPTVFFLGAILAMQFKSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IACS-010759 2mg
A12006-2 2 mg

IACS-010759 2mg

Sign In for Pricing
View Details
Rabbit TIMP1 (Tissue Inhibitors Of Metalloproteinase 1) ELISA Kit
MBS8801429-01 48 Strip Well

Rabbit TIMP1 (Tissue Inhibitors Of Metalloproteinase 1) ELISA Kit

Sign In for Pricing
View Details
Rabbit TIMP1 (Tissue Inhibitors Of Metalloproteinase 1) ELISA Kit
MBS8801429-02 96 Strip Well

Rabbit TIMP1 (Tissue Inhibitors Of Metalloproteinase 1) ELISA Kit

Sign In for Pricing
View Details
Rabbit TIMP1 (Tissue Inhibitors Of Metalloproteinase 1) ELISA Kit
MBS8801429-03 5x 96 Strip Well

Rabbit TIMP1 (Tissue Inhibitors Of Metalloproteinase 1) ELISA Kit

Sign In for Pricing
View Details
Rabbit TIMP1 (Tissue Inhibitors Of Metalloproteinase 1) ELISA Kit
MBS8801429-04 10x 96 Strip Well

Rabbit TIMP1 (Tissue Inhibitors Of Metalloproteinase 1) ELISA Kit

Sign In for Pricing
View Details
Anti-Phospho-Survivin (T34) BIRC5 Antibody
A00379T34 100 µL

Anti-Phospho-Survivin (T34) BIRC5 Antibody

Sign In for Pricing
View Details