Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Ribonuclease kappa (RNASEK)

This Recombinant Bovine Ribonuclease kappa (RNASEK) spans the amino acid sequence from region 1-98.

Product Specifications

Product Name Alternative

Ribonuclease kappa, RNase K, RNase kappa, EC= 3.1.-.-

UniProt

Q3ZC23

Expression Region

1-98

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASLLCCGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYN LYEQVSYNCFIAASLYLLLGGFSFCQVRLNKRKEYMVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL
BNC940158-100 1x 100 µL

Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
BNC401231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
BNC940270-100 1x 100 µL

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vimentin (VM1170), CF555 conjugate, 0.1mg/mL
BNC551170-100 1x 100 µL

Vimentin (VM1170), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glypican-3 (1G12), CF647 conjugate, 0.1mg/mL
BNC470862-100 1x 100 µL

Glypican-3 (1G12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), CF405S conjugate, 0.1mg/mL
BNC042602-500 1x 500 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details