Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A (ehaA)

This Recombinant Methanocaldococcus jannaschii Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A (ehaA) spans the amino acid sequence from region 1-98.

Product Specifications

Product Name Alternative

Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A

UniProt

Q57948

Expression Region

1-98

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVYNNSLLVRVMDIIILYLIALITSVIVALVLKLPIIPKEKPIRFSFETSIIFPTPILAL GIEAIFRNLFGDYISLAFFAGLFGALLSKYADKLFGEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm5936 AAV Vector (Mouse) (CMV)
22143104 1 µg

Gm5936 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Gatralimab (Biosimilar Reference Antibody) (CD52)
RA0125-01 100 µg

Gatralimab (Biosimilar Reference Antibody) (CD52)

Sign In for Pricing
View Details
Gatralimab (Biosimilar Reference Antibody) (CD52)
RA0125-02 1 mg

Gatralimab (Biosimilar Reference Antibody) (CD52)

Sign In for Pricing
View Details
Gatralimab (Biosimilar Reference Antibody) (CD52)
RA0125-03 5 mg

Gatralimab (Biosimilar Reference Antibody) (CD52)

Sign In for Pricing
View Details
Gatralimab (Biosimilar Reference Antibody) (CD52)
RA0125-04 10 mg

Gatralimab (Biosimilar Reference Antibody) (CD52)

Sign In for Pricing
View Details
Gatralimab (Biosimilar Reference Antibody) (CD52)
RA0125-05 25 mg

Gatralimab (Biosimilar Reference Antibody) (CD52)

Sign In for Pricing
View Details