Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A (ehaA)

This Recombinant Methanocaldococcus jannaschii Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A (ehaA) spans the amino acid sequence from region 1-98.

Product Specifications

Product Name Alternative

Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A

UniProt

Q57948

Expression Region

1-98

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVYNNSLLVRVMDIIILYLIALITSVIVALVLKLPIIPKEKPIRFSFETSIIFPTPILAL GIEAIFRNLFGDYISLAFFAGLFGALLSKYADKLFGEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2Q1 3'UTR Luciferase Stable Cell Line
TU027677 1.0 mL

UBE2Q1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rosuvastatin tert-butyl ester
PC111420-01 1 g

Rosuvastatin tert-butyl ester

Sign In for Pricing
View Details
Rosuvastatin tert-butyl ester
PC111420-02 5 g

Rosuvastatin tert-butyl ester

Sign In for Pricing
View Details
Rosuvastatin tert-butyl ester
PC111420-03 10 g

Rosuvastatin tert-butyl ester

Sign In for Pricing
View Details
Rosuvastatin tert-butyl ester
PC111420-04 25 g

Rosuvastatin tert-butyl ester

Sign In for Pricing
View Details
KLF10 Rabbit Polyclonal Antibody
TA343554 100 µL

KLF10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details