Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A (ehaA)

This Recombinant Methanocaldococcus jannaschii Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A (ehaA) spans the amino acid sequence from region 1-98.

Product Specifications

Product Name Alternative

Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A

UniProt

Q57948

Expression Region

1-98

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVYNNSLLVRVMDIIILYLIALITSVIVALVLKLPIIPKEKPIRFSFETSIIFPTPILAL GIEAIFRNLFGDYISLAFFAGLFGALLSKYADKLFGEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MADCAM1 Mouse Monoclonal Antibody [Clone ID: OTI2A7]
TA506919S 30 µL

MADCAM1 Mouse Monoclonal Antibody [Clone ID: OTI2A7]

Sign In for Pricing
View Details
RGS19 Antibody, Biotin conjugated
A33158-100UG 100 µg

RGS19 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Luria Agar Base, Millers Modification
M1726-500G 500 g

Luria Agar Base, Millers Modification

Sign In for Pricing
View Details
CLECSF6 (CLEC4A) (NM_194448) Human Tagged ORF Clone Lentiviral Particle
RC214844L2V 200 µL

CLECSF6 (CLEC4A) (NM_194448) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Vibrio Cholerae cysN Protein (aa 1-476)
VAng-Cr3339-50gEcoli 50 µg (E. coli)

Recombinant Vibrio Cholerae cysN Protein (aa 1-476)

Sign In for Pricing
View Details
Anti-Human CD253 APC (Clone : 2E5)
30-2613-0.1 0.1 mg

Anti-Human CD253 APC (Clone : 2E5)

Sign In for Pricing
View Details