Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Equine herpesvirus 2 Uncharacterized gene 28 protein (28)

This Recombinant Equine herpesvirus 2 Uncharacterized gene 28 protein (28) spans the amino acid sequence from region 1-98.

Product Specifications

Product Name Alternative

Uncharacterized gene 28 protein

UniProt

Q66631

Expression Region

1-98

Origin

Equine herpesvirus 2 (strain 86/87) (EHV-2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTSPTTISTTTAATTTTTTPGKGTDSPMVYIEAMLFSMLVLILLIIVCAGYVHVKNLYY RSRYGVTAIYQQVEAECRGVSLGRSVDEPPYQSIYMPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Xylella fastidiosa Transcription elongation factor GreA (greA)
MBS1418013-01 0.02 mg (E-Coli)

Recombinant Xylella fastidiosa Transcription elongation factor GreA (greA)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Transcription elongation factor GreA (greA)
MBS1418013-02 0.1 mg (E-Coli)

Recombinant Xylella fastidiosa Transcription elongation factor GreA (greA)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Transcription elongation factor GreA (greA)
MBS1418013-03 0.02 mg (Yeast)

Recombinant Xylella fastidiosa Transcription elongation factor GreA (greA)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Transcription elongation factor GreA (greA)
MBS1418013-04 0.1 mg (Yeast)

Recombinant Xylella fastidiosa Transcription elongation factor GreA (greA)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Transcription elongation factor GreA (greA)
MBS1418013-05 0.02 mg (Baculovirus)

Recombinant Xylella fastidiosa Transcription elongation factor GreA (greA)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Transcription elongation factor GreA (greA)
MBS1418013-06 0.02 mg (Mammalian-Cell)

Recombinant Xylella fastidiosa Transcription elongation factor GreA (greA)

Sign In for Pricing
View Details