Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sulfolobus islandicus rod-shaped virus 1 Uncharacterized protein 98 (98)

This Recombinant Sulfolobus islandicus rod-shaped virus 1 Uncharacterized protein 98 (98) spans the amino acid sequence from region 1-98.

Product Specifications

Product Name Alternative

Uncharacterized protein 98

UniProt

Q8QL14

Expression Region

1-98

Origin

Sulfolobus islandicus rod-shaped virus 1 (SIRV-1) (Sulfolobus virus SIRV-1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAITLLEGALYGFFAVTGVLIASFIIGEIVHLYNEKQSNENFAKAIDQMSKSTVTAIESI KDTTVTGINALLNMDTLRDVNSLAREKAKDQNPSSQAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 (BU63), CF740 conjugate, 0.1mg/mL
BNC740193-100 1x 100 µL

CD86 (BU63), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL
BNC470043-100 1x 100 µL

P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL
BNC740050-100 1x 100 µL

IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL
BNC040806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Secretory Component / ECM1 (ECM1/2889R), CF640R conjugate, 0.1mg/mL
BNC402889-100 1x 100 µL

Secretory Component / ECM1 (ECM1/2889R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF640R conjugate, 0.1mg/mL
BNC402171-500 1x 500 µL

Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details