Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanothermobacter marburgensis Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A (ehaA)

This Recombinant Methanothermobacter marburgensis Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A (ehaA) spans the amino acid sequence from region 1-98.

Product Specifications

Product Name Alternative

Probable [NiFe]-hydrogenase-type-3 Eha complex membrane subunit A

UniProt

Q9UXQ8

Expression Region

1-98

Origin

Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) (Methanobacterium thermoautotrophicum)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIIHVTYLSGYITGIISSIIISAILGLPLAPERPARHSWTPSAIFPAPIIAMGLVAICIK LGVTGMYGGVDLGVVSGLLAALMTAYFLEDIFPRPEDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alexa Fluor® 700 anti-mouse CD16/32
GT05785 25 µg

Alexa Fluor® 700 anti-mouse CD16/32

Sign In for Pricing
View Details
Human Atrogin-1 (Atrogin-1) ELISA Kit
YP-W15262-01 48 Tests

Human Atrogin-1 (Atrogin-1) ELISA Kit

Sign In for Pricing
View Details
Human Atrogin-1 (Atrogin-1) ELISA Kit
YP-W15262-02 96 Tests

Human Atrogin-1 (Atrogin-1) ELISA Kit

Sign In for Pricing
View Details
FRAS1 AAV siRNA Pooled Vector
20928161 1.0 µg

FRAS1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
THRB siRNA (Human)
MBS8229008-01 15 nmol

THRB siRNA (Human)

Sign In for Pricing
View Details
THRB siRNA (Human)
MBS8229008-02 30 nmol

THRB siRNA (Human)

Sign In for Pricing
View Details