Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Scaphirhynchus platorynchus Cytochrome b (mt-cyb)

This Recombinant Scaphirhynchus platorynchus Cytochrome b (mt-cyb) spans the amino acid sequence from region 1-98.

Product Specifications

Product Name Alternative

Cytochrome b, Complex III subunit 3, Complex III subunit III, Cytochrome b-c1 complex subunit 3, Ubiquinol-cytochrome-c reductase complex cytochrome b subunit

UniProt

P29672

Expression Region

1-98

Origin

Scaphirhynchus platorynchus (Shovelnose sturgeon) (Acipenser platorynchus)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LLGLCLITQILTGLFLAMHYTADISTAFSSVAHICRDVNYGWLIRNVHANGASFFFICLY LHVARGMYYGSYLQKETWNIGVVLLLLTMMTAFVGYVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL
BNC682848-500 1x 500 µL

Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-500 1x 500 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL
BNC740977-500 1x 500 µL

TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL
BNC470178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1486), CF568 conjugate, 0.1mg/mL
BNC681486-500 1x 500 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1486), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (LK2H10), CF640R conjugate, 0.1mg/mL
BNC400641-500 1x 500 µL

Chromogranin A (LK2H10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details