Recombinant Grapevine leafroll-associated virus 3 Protein P7 (ORF12)
This Recombinant Grapevine leafroll-associated virus 3 Protein P7 (ORF12) spans the amino acid sequence from region 1-60.
Product Specifications
Product Name Alternative
Protein P7, 7 kDa protein
UniProt
O71197
Expression Region
1-60
Origin
Grapevine leafroll-associated virus 3 (isolate United States/NY1) (GLRaV-3) (Grapevine leafroll-associated closterovirus (isolate 109) )
Field of Research
Infectious Disease & Virology; Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MRHLEKPIRVAVHYCVVRSDVCDGWDVFIGVTLIGMFISYYLYALISICRKGEGLTTSNG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog