Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Grapevine leafroll-associated virus 3 Protein P7 (ORF12)

This Recombinant Grapevine leafroll-associated virus 3 Protein P7 (ORF12) spans the amino acid sequence from region 1-60.

Product Specifications

Product Name Alternative

Protein P7, 7 kDa protein

UniProt

O71197

Expression Region

1-60

Origin

Grapevine leafroll-associated virus 3 (isolate United States/NY1) (GLRaV-3) (Grapevine leafroll-associated closterovirus (isolate 109) )

Field of Research

Infectious Disease & Virology; Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRHLEKPIRVAVHYCVVRSDVCDGWDVFIGVTLIGMFISYYLYALISICRKGEGLTTSNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITI-H3 shRNA (h) Lentiviral Particles
sc-39599-V 200 µL

ITI-H3 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Bovine Beta-Ala-His dipeptidase (CNDP1) ELISA Kit
OM621284 96 Strip Well

Bovine Beta-Ala-His dipeptidase (CNDP1) ELISA Kit

Sign In for Pricing
View Details
Phthalic Acid-13C2
MBS6115624-01 50 mg

Phthalic Acid-13C2

Sign In for Pricing
View Details
Phthalic Acid-13C2
MBS6115624-02 5x 50 mg

Phthalic Acid-13C2

Sign In for Pricing
View Details
ELP3 Rabbit Polyclonal Antibody
E53P09343 100 µL

ELP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Azeloprazole
M16817-01 1 g

Azeloprazole

Sign In for Pricing
View Details