Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Grapevine leafroll-associated virus 3 Protein P7 (ORF12)

This Recombinant Grapevine leafroll-associated virus 3 Protein P7 (ORF12) spans the amino acid sequence from region 1-60.

Product Specifications

Product Name Alternative

Protein P7, 7 kDa protein

UniProt

O71197

Expression Region

1-60

Origin

Grapevine leafroll-associated virus 3 (isolate United States/NY1) (GLRaV-3) (Grapevine leafroll-associated closterovirus (isolate 109) )

Field of Research

Infectious Disease & Virology; Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRHLEKPIRVAVHYCVVRSDVCDGWDVFIGVTLIGMFISYYLYALISICRKGEGLTTSNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSC194598
BA9001-1 1 mg

NSC194598

Sign In for Pricing
View Details
Canine Bcl 2 like protein 10 (BCL2L10) ELISA kit
GTR10422508 96 Well

Canine Bcl 2 like protein 10 (BCL2L10) ELISA kit

Sign In for Pricing
View Details
NPPC polyclonal antibody
orb645428-01 50 μL

NPPC polyclonal antibody

Sign In for Pricing
View Details
NPPC polyclonal antibody
orb645428-02 100 µL

NPPC polyclonal antibody

Sign In for Pricing
View Details
NPPC polyclonal antibody
orb645428-03 200 µL

NPPC polyclonal antibody

Sign In for Pricing
View Details
Rat Monoclonal IL-27/IL-35 EBI3 Subunit Antibody (10J763) [PerCP]
NBP2-03939PCP 0.1 mL

Rat Monoclonal IL-27/IL-35 EBI3 Subunit Antibody (10J763) [PerCP]

Sign In for Pricing
View Details