Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Protein BNLF2a (BNLF2a)

This Recombinant Epstein-Barr virus Protein BNLF2a (BNLF2a) spans the amino acid sequence from region 1-60.

Product Specifications

Product Name Alternative

Protein BNLF2a

UniProt

P0C738

Expression Region

1-60

Origin

Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVHVLERALLEQQSSACGLPGSSTETRPSHPCPEDPDVSRLRLLLVVLCVLFGLLCLLLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ZFP64 Protein - (Dry Ice)
H00055734-P01-25ug 25 µg

Recombinant Human ZFP64 Protein - (Dry Ice)

Sign In for Pricing
View Details
TAGLN (Transgelin, DKFZp686P11128, SM22, SMCC, TAGLN1, WS3-10)
252362 100 µg

TAGLN (Transgelin, DKFZp686P11128, SM22, SMCC, TAGLN1, WS3-10)

Sign In for Pricing
View Details
PHLPII (Pollen Allergen Phl P 2) Antibody
abx422461-01 100 µg

PHLPII (Pollen Allergen Phl P 2) Antibody

Sign In for Pricing
View Details
PHLPII (Pollen Allergen Phl P 2) Antibody
abx422461-02 1 mg

PHLPII (Pollen Allergen Phl P 2) Antibody

Sign In for Pricing
View Details
TPM3 Polyclonal Antibody
MBS9133593-01 0.02 mL

TPM3 Polyclonal Antibody

Sign In for Pricing
View Details
TPM3 Polyclonal Antibody
MBS9133593-02 0.1 mL

TPM3 Polyclonal Antibody

Sign In for Pricing
View Details