Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Protein BNLF2a (BNLF2a)

This Recombinant Epstein-Barr virus Protein BNLF2a (BNLF2a) spans the amino acid sequence from region 1-60.

Product Specifications

Product Name Alternative

Protein BNLF2a

UniProt

P0C738

Expression Region

1-60

Origin

Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVHVLERALLEQQSSACGLPGSSTETRPSHPCPEDPDVSRLRLLLVVLCVLFGLLCLLLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 (PECAM1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F9]
TA504798AM 100 µL

CD31 (PECAM1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F9]

Sign In for Pricing
View Details
Human CCL8 Protein Lysate
MBS138934-01 0.02 mg

Human CCL8 Protein Lysate

Sign In for Pricing
View Details
Human CCL8 Protein Lysate
MBS138934-02 5x 0.02 mg

Human CCL8 Protein Lysate

Sign In for Pricing
View Details
TIMP1 Mouse Monoclonal Antibody (AP)
orb1816545 100 µL

TIMP1 Mouse Monoclonal Antibody (AP)

Sign In for Pricing
View Details
S 1592
HY-123220 1 Each

S 1592

Sign In for Pricing
View Details
Foxa3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6875608 1.0 µg DNA

Foxa3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details