Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Protein BNLF2a (BNLF2a)

This Recombinant Epstein-Barr virus Protein BNLF2a (BNLF2a) spans the amino acid sequence from region 1-60.

Product Specifications

Product Name Alternative

Protein BNLF2a

UniProt

P0C738

Expression Region

1-60

Origin

Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVHVLERALLEQQSSACGLPGSSTETRPSHPCPEDPDVSRLRLLLVVLCVLFGLLCLLLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 10 (Il-10) (AP) discontinued
I8432-13C-AP 100 µL

Interleukin 10 (Il-10) (AP) discontinued

Sign In for Pricing
View Details
GAGE10 3'UTR Luciferase Stable Cell Line
TU008497 1.0 mL

GAGE10 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PTGDR ORF Vector (Human) (pORF)
ORF028517 1.0 µg DNA

PTGDR ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Sdhd siRNA Oligos set (Rat)
43257176 3x 5 nmol

Sdhd siRNA Oligos set (Rat)

Sign In for Pricing
View Details
4-Methylumbelliferyl a-D-mannopyranoside
257718-01 100 mg

4-Methylumbelliferyl a-D-mannopyranoside

Sign In for Pricing
View Details
4-Methylumbelliferyl a-D-mannopyranoside
257718-02 250 mg

4-Methylumbelliferyl a-D-mannopyranoside

Sign In for Pricing
View Details