Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein ydzN (ydzN)

This Recombinant Uncharacterized membrane protein ydzN (ydzN) spans the amino acid sequence from region 1-61.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ydzN

UniProt

C0H3V7

Expression Region

1-61

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRWSKWFNVFCIVALGSIYGYKLFTNQEVSTTRLIIASVIVLWNIVGLFSKESVKQAQQA N

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XPNPEP1 (1-623aa) Monoclonal Antibody
E53M01377 100 µL

XPNPEP1 (1-623aa) Monoclonal Antibody

Sign In for Pricing
View Details
3-nitro-4- (2-pyridylthio) benzaldehyde
OR26080 1 Each

3-nitro-4- (2-pyridylthio) benzaldehyde

Sign In for Pricing
View Details
GLUT2 Polyclonal Antibody, FITC Conjugated
bs-10379R-FITC 100 µL

GLUT2 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
MAP6 Antibody - middle region
ARP60315_P050-25UL 25 µL

MAP6 Antibody - middle region

Sign In for Pricing
View Details
Adenosine A1-R (m) -PR
sc-39849-PR 10 µM - 20 µL

Adenosine A1-R (m) -PR

Sign In for Pricing
View Details
Human SLC6A16 knockout cell line
ABC-KH14172 1 Vial

Human SLC6A16 knockout cell line

Sign In for Pricing
View Details