Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein ydzN (ydzN)

This Recombinant Uncharacterized membrane protein ydzN (ydzN) spans the amino acid sequence from region 1-61.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ydzN

UniProt

C0H3V7

Expression Region

1-61

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRWSKWFNVFCIVALGSIYGYKLFTNQEVSTTRLIIASVIVLWNIVGLFSKESVKQAQQA N

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gocatamig
T9901A-355-01 1 mg

Gocatamig

Sign In for Pricing
View Details
Gocatamig
T9901A-355-02 5 mg

Gocatamig

Sign In for Pricing
View Details
Plant Histone Acetyltransferase 1 (HAT1) ELISA Kit
MBS9376989 Inquire

Plant Histone Acetyltransferase 1 (HAT1) ELISA Kit

Sign In for Pricing
View Details
Human TOMM20 activation kit by CRISPRa
GA106603 1 Kit

Human TOMM20 activation kit by CRISPRa

Sign In for Pricing
View Details
PHF7 Mouse Monoclonal Antibody [Clone ID: OTI1A2]
TA505118S 30 µL

PHF7 Mouse Monoclonal Antibody [Clone ID: OTI1A2]

Sign In for Pricing
View Details
125-500 mL single-use bottle cap (NG)
BIOBGCBP382003 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

125-500 mL single-use bottle cap (NG)

Sign In for Pricing
View Details