Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella sonnei Uncharacterized protein ytcA (ytcA)

This Recombinant Shigella sonnei Uncharacterized protein ytcA (ytcA) spans the amino acid sequence from region 27-91.

Product Specifications

Product Name Alternative

Uncharacterized protein ytcA

UniProt

Q3YUQ3

Expression Region

27-91

Origin

Shigella sonnei (strain Ss046)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSLSPAIPVIGAYYPSWFFCAIASLILMLITRRVIQRANINLAFVGIIYTALFALYAMLF WLAFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HA Tag (16.43), 1mg/mL
BNUM2543-50 1x 50 µL

HA Tag (16.43), 1mg/mL

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker) (rIGEL/773), CF405S conjugate, 0.1mg/mL
BNC041829-100 1x 100 µL

CD20 / MS4A1 (B-Cell Marker) (rIGEL/773), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Myc tag, AlpHcAbs® Rabbit antibody
HA710209 100 µg

Myc tag, AlpHcAbs® Rabbit antibody

Sign In for Pricing
View Details
ATP5A (ATP5A1) (C-term) Rabbit Polyclonal Antibody
AP50297PU-N 400 µL

ATP5A (ATP5A1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GM-CSF Antibody
KC-9269-01 50 μL

GM-CSF Antibody

Sign In for Pricing
View Details
GM-CSF Antibody
KC-9269-02 100 µL

GM-CSF Antibody

Sign In for Pricing
View Details