Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella sonnei Uncharacterized protein ytcA (ytcA)

This Recombinant Shigella sonnei Uncharacterized protein ytcA (ytcA) spans the amino acid sequence from region 27-91.

Product Specifications

Product Name Alternative

Uncharacterized protein ytcA

UniProt

Q3YUQ3

Expression Region

27-91

Origin

Shigella sonnei (strain Ss046)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSLSPAIPVIGAYYPSWFFCAIASLILMLITRRVIQRANINLAFVGIIYTALFALYAMLF WLAFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,6-di-tert-Butylpyridine
TRC-B692775-5G 5 g

2,6-di-tert-Butylpyridine

Sign In for Pricing
View Details
EBP1 Recombinant Rabbit Monoclonal Antibody [JE35-48]
HA721315 100 µL

EBP1 Recombinant Rabbit Monoclonal Antibody [JE35-48]

Sign In for Pricing
View Details
STAT6 (Solitary Fibrous Tumor Marker) (STAT6/2410), 0.2mg/mL
BNUB2410-500 1x 500 µL

STAT6 (Solitary Fibrous Tumor Marker) (STAT6/2410), 0.2mg/mL

Sign In for Pricing
View Details
Apigenin 7-Sulfate-O-N,N,N-tributyl-1-butanaminium
TRC-A726495-25MG 25 mg

Apigenin 7-Sulfate-O-N,N,N-tributyl-1-butanaminium

Sign In for Pricing
View Details
Human PCTAIRE3 (CDK18) activation kit by CRISPRa
GA103428 1 Kit

Human PCTAIRE3 (CDK18) activation kit by CRISPRa

Sign In for Pricing
View Details
CD9 (TSPAN29) (Motility-Related Protein-1) (P1/33/2), 1mg/mL
BNUM2218-50 1x 50 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (P1/33/2), 1mg/mL

Sign In for Pricing
View Details