Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE)

This Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-66.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B2IQX6

Expression Region

1-66

Origin

Streptococcus pneumoniae (strain CGSP14)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLV FSFIIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipoprotein L 1 (APOL1) Mouse Monoclonal Antibody [Clone ID: OTI5H4]
CF812044 100 µg

Apolipoprotein L 1 (APOL1) Mouse Monoclonal Antibody [Clone ID: OTI5H4]

Sign In for Pricing
View Details
ZNF75A Human Gene Knockout Kit (CRISPR)
KN420339 1 Kit

ZNF75A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VISTA Recombinant Rabbit monoclonal Antibody
HA750642 100 µL

VISTA Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD117 (C117/370), CF740 conjugate, 0.1mg/mL
BNC740370-100 1x 100 µL

CD117 (C117/370), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FGD3 (NM_001083536) Human Over-expression Lysate
LC421216 20 µg

FGD3 (NM_001083536) Human Over-expression Lysate

Sign In for Pricing
View Details
DRG1 (NM_004147) Human Over-expression Lysate
LY401336 100 µg

DRG1 (NM_004147) Human Over-expression Lysate

Sign In for Pricing
View Details