Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE)

This Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-66.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B2IQX6

Expression Region

1-66

Origin

Streptococcus pneumoniae (strain CGSP14)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLV FSFIIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKK beta Antibody (phospho-S705)
F48708-0.08ML 0.08 mL

IKK beta Antibody (phospho-S705)

Sign In for Pricing
View Details
NBD-ethylenediamine
#90047 1x 10 mg

NBD-ethylenediamine

Sign In for Pricing
View Details
Histone H1 (1415-1), CF640R conjugate, 0.1mg/mL
BNC400580-500 1x 500 µL

Histone H1 (1415-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyoD1 (MYD712), CF594 conjugate, 0.1mg/mL
BNC940712-100 1x 100 µL

MyoD1 (MYD712), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Digoxigenin-dUTP, Alkali Stable
#40078 1x 25 nmol

Digoxigenin-dUTP, Alkali Stable

Sign In for Pricing
View Details
Frozen Tissue Sections, Testis
CS502312 5x 5 µm

Frozen Tissue Sections, Testis

Sign In for Pricing
View Details