Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella agona Protein AaeX (aaeX)

This Recombinant Salmonella agona Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

B5F7M6

Expression Region

1-67

Origin

Salmonella agona (strain SL483)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRMLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Heptakis(6-O-sulfo)-Beta-cyclodextrin Heptasodium Salt (>90%)
TRC-H281125-100MG 100 mg

Heptakis(6-O-sulfo)-Beta-cyclodextrin Heptasodium Salt (>90%)

Sign In for Pricing
View Details
PacOrange Anti-human CD4 Antibody *RPA-T4*
100411K0-AAT 100 Tests

PacOrange Anti-human CD4 Antibody *RPA-T4*

Sign In for Pricing
View Details
4-Phenylazophenol (Solvent Yellow 7,4-HAB) extrapure, 98%
53993-01 25 g

4-Phenylazophenol (Solvent Yellow 7,4-HAB) extrapure, 98%

Sign In for Pricing
View Details
4-Phenylazophenol (Solvent Yellow 7,4-HAB) extrapure, 98%
53993-02 100 g

4-Phenylazophenol (Solvent Yellow 7,4-HAB) extrapure, 98%

Sign In for Pricing
View Details
DRD4 Adenovirus (Mouse)
18597054 1.0 mL

DRD4 Adenovirus (Mouse)

Sign In for Pricing
View Details
4- (Benzyloxy) -2,5-dichlorobenzoic acid
OR1089623-01 250 mg

4- (Benzyloxy) -2,5-dichlorobenzoic acid

Sign In for Pricing
View Details