Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Protein AaeX (aaeX)

This Recombinant Escherichia coli Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

B7LHV0

Expression Region

1-67

Origin

Escherichia coli (strain 55989 / EAEC)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2552), CF568 conjugate, 0.1mg/mL
BNC682552-100 1x 100 µL

AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2552), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1orf222 (NM_001003808) Human Recombinant Protein
TP321806M 100 µg

C1orf222 (NM_001003808) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Joint
CS714910 5x 5 µm

Tissue FFPE Sections, Joint

Sign In for Pricing
View Details
Recombinant GSTM2 Monoclonal Antibody
AN300247P 100 µL

Recombinant GSTM2 Monoclonal Antibody

Sign In for Pricing
View Details
Di(2-(4-(dibenzo[b,f][1,4]thiazepin-11-yl)piperazin-1-yl))-2-propoxyethyl Propionate
TRC-D417110-10MG 10 mg

Di(2-(4-(dibenzo[b,f][1,4]thiazepin-11-yl)piperazin-1-yl))-2-propoxyethyl Propionate

Sign In for Pricing
View Details
Rabies (Rab-50), CF647 conjugate, 0.1mg/mL
BNC470943-500 1x 500 µL

Rabies (Rab-50), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details