Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Protein AaeX (aaeX)

This Recombinant Escherichia coli Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

B7LHV0

Expression Region

1-67

Origin

Escherichia coli (strain 55989 / EAEC)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hydrocortisone (Cortisol)
TRC-H714615-250MG 250 mg

Hydrocortisone (Cortisol)

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD45R (B220) Antibody[RA3-6B2]
AN00428H-01 50 Tests

PE/Cyanine7 Anti-Mouse CD45R (B220) Antibody[RA3-6B2]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD45R (B220) Antibody[RA3-6B2]
AN00428H-02 100 Tests

PE/Cyanine7 Anti-Mouse CD45R (B220) Antibody[RA3-6B2]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD45R (B220) Antibody[RA3-6B2]
AN00428H-03 2x 100 Tests

PE/Cyanine7 Anti-Mouse CD45R (B220) Antibody[RA3-6B2]

Sign In for Pricing
View Details
Annexin V, Allophycocyanin Crosslinked Conjugate (100 assays)
#29057-500uL 1x 500 µL

Annexin V, Allophycocyanin Crosslinked Conjugate (100 assays)

Sign In for Pricing
View Details
Human Lipocalin like 1 protein (LCNL1) activation kit by CRISPRa
GA118339 1 Kit

Human Lipocalin like 1 protein (LCNL1) activation kit by CRISPRa

Sign In for Pricing
View Details