Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yopZ (yopZ)

This Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yopZ (yopZ) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

SPBc2 prophage-derived uncharacterized protein yopZ

UniProt

O34509

Expression Region

1-67

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSEMQLQAQIDVIEKENKELRRRNEELGQTVECQNKQIVTQNWRLLFFASSWIVYGIVS AIKYLWG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THTPA (NM_001126339) Human Over-expression Lysate
LC426679 20 µg

THTPA (NM_001126339) Human Over-expression Lysate

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (r6E1), CF568 conjugate, 0.1mg/mL
BNC681969-100 1x 100 µL

Thyroglobulin (Thyroidal Cell Marker) (r6E1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Cep89 activation kit by CRISPRa
GA209124 1 Kit

Mouse Cep89 activation kit by CRISPRa

Sign In for Pricing
View Details
DDR2 (NM_001014796) Human Over-expression Lysate
LC423080 20 µg

DDR2 (NM_001014796) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS712773 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
BPNT1 Human Gene Knockout Kit (CRISPR)
KN416622 1 Kit

BPNT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details