Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yopZ (yopZ)

This Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yopZ (yopZ) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

SPBc2 prophage-derived uncharacterized protein yopZ

UniProt

O34509

Expression Region

1-67

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSEMQLQAQIDVIEKENKELRRRNEELGQTVECQNKQIVTQNWRLLFFASSWIVYGIVS AIKYLWG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scanning UV Visible Spectrophotometer BSSNU-104
BSSNU-104 Each

Scanning UV Visible Spectrophotometer BSSNU-104

Sign In for Pricing
View Details
Mitochondrial Marker (AE-1), 1mg/mL
BNUM0905-50 1x 50 µL

Mitochondrial Marker (AE-1), 1mg/mL

Sign In for Pricing
View Details
Dihydrodiol Ibrutinib
TRC-D450250-5MG 5 mg

Dihydrodiol Ibrutinib

Sign In for Pricing
View Details
ITIH5 Human Gene Knockout Kit (CRISPR)
KN214478 1 Kit

ITIH5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Timm44 Mouse Gene Knockout Kit (CRISPR)
KN517579 1 Kit

Timm44 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IFluor® Ultra 647 succinimidyl ester
71670-AAT 1 mg

IFluor® Ultra 647 succinimidyl ester

Sign In for Pricing
View Details