Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yopZ (yopZ)

This Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yopZ (yopZ) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

SPBc2 prophage-derived uncharacterized protein yopZ

UniProt

O34509

Expression Region

1-67

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSEMQLQAQIDVIEKENKELRRRNEELGQTVECQNKQIVTQNWRLLFFASSWIVYGIVS AIKYLWG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-(4-Formylphenyl)-4-piperidinecarboxylic Acid
TRC-B594025-500MG 500 mg

1-(4-Formylphenyl)-4-piperidinecarboxylic Acid

Sign In for Pricing
View Details
Bufencarb
TRC-B689385-10MG 10 mg

Bufencarb

Sign In for Pricing
View Details
Fura-2, Pentapotassium Salt
#50031 1x 1 mg

Fura-2, Pentapotassium Salt

Sign In for Pricing
View Details
Rab14 Mouse Gene Knockout Kit (CRISPR)
KN514333 1 Kit

Rab14 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
APOB48R (APOBR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7A7]
TA807169AM 100 µL

APOB48R (APOBR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7A7]

Sign In for Pricing
View Details
Golgi Complex (AE-6), CF488A conjugate, 0.1mg/mL
BNC880868-100 1x 100 µL

Golgi Complex (AE-6), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details