Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Protein AaeX (aaeX)

This Recombinant Escherichia coli Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q1R697

Expression Region

1-67

Origin

Escherichia coli (strain UTI89 / UPEC)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS647646 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS705679 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
PDGF Receptor alpha (PDGFRA) Rabbit Polyclonal Antibody
TA379745 100 µL

PDGF Receptor alpha (PDGFRA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZFP200 (ZNF200) (NM_198088) Human Recombinant Protein
TP760732 50 µg

ZFP200 (ZNF200) (NM_198088) Human Recombinant Protein

Sign In for Pricing
View Details
ROBO3 Polyclonal Antibody
E-AB-67631-01 60 µL

ROBO3 Polyclonal Antibody

Sign In for Pricing
View Details
ROBO3 Polyclonal Antibody
E-AB-67631-02 120 µL

ROBO3 Polyclonal Antibody

Sign In for Pricing
View Details