Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Protein AaeX (aaeX)

This Recombinant Escherichia coli Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q1R697

Expression Region

1-67

Origin

Escherichia coli (strain UTI89 / UPEC)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse TALLA-1/TSPAN7 Protein (His Tag)
PKSM040452 100 µg

Recombinant Mouse TALLA-1/TSPAN7 Protein (His Tag)

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1773R), Biotin conjugate, 0.1mg/mL
BNCB1773-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1773R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neutrophils Mouse Monoclonal Antibody [Clone ID: PM1]
AM26132PU-N 200 µg

Neutrophils Mouse Monoclonal Antibody [Clone ID: PM1]

Sign In for Pricing
View Details
Tissue FFPE Sections, Myometrium
CS700534 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
Tissue FFPE Sections, Cervix
CS802107 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
Gastrin (GAST) (NM_000805) Human Recombinant Protein
TP310222L 1 mg

Gastrin (GAST) (NM_000805) Human Recombinant Protein

Sign In for Pricing
View Details