Recombinant Protein AaeX (aaeX)
This Recombinant Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.
Product Specifications
Product Name Alternative
Protein AaeX
UniProt
Q7UBE9
Expression Region
1-67
Origin
Shigella flexneri
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-5238R-Biotin 100 µL
Phospho-CDKN1A/p21 (Thr57) Polyclonal Antibody, Biotin Conjugated
Sign In for Pricing
View Details 037806-PE 200 µL
LINGO-1, CT (S596) (LRRN6A) (Lingo1, Lern1, Lrrn6a, Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1, Leucine-rich repeat neuronal protein 1, Leucine-rich repeat neuronal protein 6A) (PE) discontinued
Sign In for Pricing
View Details MBS146774-01 0.001 mg
Recombinant Human Matrix Metalloproteinase-14
Sign In for Pricing
View Details