Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein AaeX (aaeX)

This Recombinant Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q7UBE9

Expression Region

1-67

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VR1 (TRPV1) (NM_080705) Human Over-expression Lysate
LY409038 100 µg

VR1 (TRPV1) (NM_080705) Human Over-expression Lysate

Sign In for Pricing
View Details
CPB2 Antibody (FITC)
orb52489-01 50 µg

CPB2 Antibody (FITC)

Sign In for Pricing
View Details
CPB2 Antibody (FITC)
orb52489-02 100 µg

CPB2 Antibody (FITC)

Sign In for Pricing
View Details
Zebrafish Nap1l4a Rabbit Polyclonal Antibody (Fluoro594)
orb3088962 200 µL

Zebrafish Nap1l4a Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
GABAA Rα6 rabbit pAb
ES2388-01 50 µL

GABAA Rα6 rabbit pAb

Sign In for Pricing
View Details
GABAA Rα6 rabbit pAb
ES2388-02 100 µL

GABAA Rα6 rabbit pAb

Sign In for Pricing
View Details