Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0287945 (DDB_G0287945)

This Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0287945 (DDB_G0287945) spans the amino acid sequence from region 1-68.

Product Specifications

Product Name Alternative

Putative uncharacterized transmembrane protein DDB_G0287945

UniProt

Q54JN2

Expression Region

1-68

Origin

Dictyostelium discoideum (Slime mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDINKNEINLNRQFSRHVPDEWDFFENSPGENNFLENKSQIRGIFFFFFFFFFFILLILD LIIIIGEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
BNC470149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (57), CF568 conjugate, 0.1mg/mL
BNC680139-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (57), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX6 (PAX6/1166), CF640R conjugate, 0.1mg/mL
BNC401166-100 1x 100 µL

PAX6 (PAX6/1166), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/1714), CF405S conjugate, 0.1mg/mL
BNC041714-100 1x 100 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/1714), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2416), CF488A conjugate, 0.1mg/mL
BNC882416-500 1x 500 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2416), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8/803), CF405S conjugate, 0.1mg/mL
BNC040803-500 1x 500 µL

Cytokeratin 8 (KRT8/803), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details