Recombinant Porcine reproductive and respiratory syndrome virus Envelope small membrane protein (GP2b)
This Recombinant Porcine reproductive and respiratory syndrome virus Envelope small membrane protein (GP2b) spans the amino acid sequence from region 2-70.
Product Specifications
Product Name Alternative
Envelope small membrane protein, Protein E, Glycoprotein 2b, Protein GP2b, Gs
UniProt
A0MD31
Expression Region
2-70
Origin
Porcine reproductive and respiratory syndrome virus (isolate Pig/United States/SD 01-08/2001) (PRRSV)
Field of Research
Infectious Disease & Virology; Respiratory Research; Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
GSLWSKISQLFVDAFTEFLVSVVDIVIFLAILFGFTVAGWLLVFLLRVVCSALLRSRSAI HSPELSKVL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog