Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0521 (MJ0521)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0521 (MJ0521) spans the amino acid sequence from region 1-69.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0521

UniProt

Q57941

Expression Region

1-69

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNMDEERKYGLYSLIIGLLCVIGIVMLNGLICYVLYIIAVPSLLYGIGAFIIPKTRRKD AGKLPFRGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ovary: right
CS626181 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details
HMG-CoA Sodium Salt
TRC-H456790-5MG 5 mg

HMG-CoA Sodium Salt

Sign In for Pricing
View Details
Human FAM154B (SAXO2) activation kit by CRISPRa
GA117054 1 Kit

Human FAM154B (SAXO2) activation kit by CRISPRa

Sign In for Pricing
View Details
Munc18c (STXBP3) (Center) Rabbit Polyclonal Antibody
AP54096PU-N 400 µL

Munc18c (STXBP3) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Prolactin Receptor (B6.2 + PRLR742), CF488A conjugate, 0.1mg/mL
BNC880744-500 1x 500 µL

Prolactin Receptor (B6.2 + PRLR742), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ANKRD45 activation kit by CRISPRa
GA117423 1 Kit

Human ANKRD45 activation kit by CRISPRa

Sign In for Pricing
View Details