Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit c (atpE)

This Recombinant Staphylococcus aureus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A7X4V0

Expression Region

1-70

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse monoclonal CA 19-9 antibody
MBS5305313-01 0.5 mg

Mouse monoclonal CA 19-9 antibody

Sign In for Pricing
View Details
Mouse monoclonal CA 19-9 antibody
MBS5305313-02 5x 0.5 mg

Mouse monoclonal CA 19-9 antibody

Sign In for Pricing
View Details
Cttnbp2 Rat shRNA Plasmid (Locus ID 282587)
TR708241 1 Kit

Cttnbp2 Rat shRNA Plasmid (Locus ID 282587)

Sign In for Pricing
View Details
hsa-miR-1277 miRNA Inhibitor
MIH01201 2x 5.0 nmol

hsa-miR-1277 miRNA Inhibitor

Sign In for Pricing
View Details
Recombinant Clostridium Acetobutylicum cobB Protein (aa 1-245)
VAng-Lsx7524-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Acetobutylicum cobB Protein (aa 1-245)

Sign In for Pricing
View Details
Pacific Blue™ anti-human CD304 (Neuropilin-1)
GT13432 100 Tests

Pacific Blue™ anti-human CD304 (Neuropilin-1)

Sign In for Pricing
View Details