Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit c (atpE)

This Recombinant Staphylococcus aureus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A7X4V0

Expression Region

1-70

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100A9 + Calprotectin (S100A8/A9 Complex) (MAC3157R), 1mg/mL
BNUM3157-50 1x 50 µL

S100A9 + Calprotectin (S100A8/A9 Complex) (MAC3157R), 1mg/mL

Sign In for Pricing
View Details
TNK1 Antibody
F40161-0.4ML 0.4 mL

TNK1 Antibody

Sign In for Pricing
View Details
Recombinant Human GSTM5
P9858-01 50 µg

Recombinant Human GSTM5

Sign In for Pricing
View Details
Recombinant Human GSTM5
P9858-02 200 µg

Recombinant Human GSTM5

Sign In for Pricing
View Details
Recombinant Human GSTM5
P9858-03 1 mg

Recombinant Human GSTM5

Sign In for Pricing
View Details
FADD Protein Lysate (Human) with C-Ha Tag
19661031 100 µg

FADD Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details