Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Glycoprotein N (gN)

This Recombinant Epstein-Barr virus Glycoprotein N (gN) spans the amino acid sequence from region 33-102.

Product Specifications

Product Name Alternative

Glycoprotein N, gN

UniProt

P0C6Z3

Expression Region

33-102

Origin

Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SSPTNAAAASLTEAQDQFYSYTCNADTFSPSLTSFASIWALLTLVLVIIASAIYLMYVCF NKFVNTLLTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAU2 (NM_001164384) Human Over-expression Lysate
LY431953 100 µg

STAU2 (NM_001164384) Human Over-expression Lysate

Sign In for Pricing
View Details
TAF9 (NM_001015892) Human Over-expression Lysate
LY423137 100 µg

TAF9 (NM_001015892) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant MYH6 Antibody
RC-16807-01 50 μL

Recombinant MYH6 Antibody

Sign In for Pricing
View Details
Recombinant MYH6 Antibody
RC-16807-02 100 µL

Recombinant MYH6 Antibody

Sign In for Pricing
View Details
Recombinant MYH6 Antibody
RC-16807-03 1 mL

Recombinant MYH6 Antibody

Sign In for Pricing
View Details
SCIN Antibody
KC-29408-01 50 μL

SCIN Antibody

Sign In for Pricing
View Details