Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Glycoprotein N (gN)

This Recombinant Epstein-Barr virus Glycoprotein N (gN) spans the amino acid sequence from region 33-102.

Product Specifications

Product Name Alternative

Glycoprotein N, gN

UniProt

P0C6Z3

Expression Region

33-102

Origin

Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SSPTNAAAASLTEAQDQFYSYTCNADTFSPSLTSFASIWALLTLVLVIIASAIYLMYVCF NKFVNTLLTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LSP1 (261-275) Goat Polyclonal Antibody
AP23727PU-N 100 µg

LSP1 (261-275) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Psoralen MOP Succinimidyl Ester
39055-AAT 5 mg

Psoralen MOP Succinimidyl Ester

Sign In for Pricing
View Details
P14ARF (4C6/4), CF568 conjugate, 0.1mg/mL
BNC682088-500 1x 500 µL

P14ARF (4C6/4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Protein A/G Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS
MTB08F4-PAG/W 10x 96 Well Plates

Protein A/G Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS

Sign In for Pricing
View Details
PAICS Antibody
KC-32092-01 50 μL

PAICS Antibody

Sign In for Pricing
View Details
PAICS Antibody
KC-32092-02 100 µL

PAICS Antibody

Sign In for Pricing
View Details