Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus ATP synthase subunit c (atpE)

This Recombinant Bacillus cereus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B7JGN5

Expression Region

1-72

Origin

Bacillus cereus (strain AH820)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase-10 Antibody
252225 0.1 mg

Caspase-10 Antibody

Sign In for Pricing
View Details
Anti-mouse CD19-InVivo
A2149-5mg*5 5x 5mg

Anti-mouse CD19-InVivo

Sign In for Pricing
View Details
Anti-LAIR1 Antibody, Rabbit Polyclonal
MBS8108186-01 0.1 mL

Anti-LAIR1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-LAIR1 Antibody, Rabbit Polyclonal
MBS8108186-02 5x 0.1 mL

Anti-LAIR1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Cib2 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3434102 1.0 µg DNA

Cib2 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
ACOX3 Lentiviral Activation Particles (m)
sc-429851-LAC 200 µL

ACOX3 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details