Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus ATP synthase subunit c (atpE)

This Recombinant Bacillus cereus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B7JGN5

Expression Region

1-72

Origin

Bacillus cereus (strain AH820)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2463708 1.0 µg DNA

TRIM9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
N1-Methylxylo-guanosine
orb1982358-01 5 mg

N1-Methylxylo-guanosine

Sign In for Pricing
View Details
N1-Methylxylo-guanosine
orb1982358-02 50 mg

N1-Methylxylo-guanosine

Sign In for Pricing
View Details
HRP-Goat Anti-Horse IgG (H+L)
FNSA-0013-01 100 µL

HRP-Goat Anti-Horse IgG (H+L)

Sign In for Pricing
View Details
HRP-Goat Anti-Horse IgG (H+L)
FNSA-0013-02 500 µL

HRP-Goat Anti-Horse IgG (H+L)

Sign In for Pricing
View Details
ACE2 Antibody : HRP (OAPB00214-HRP)
OAPB00214-100UG-HRP 0.1 mg

ACE2 Antibody : HRP (OAPB00214-HRP)

Sign In for Pricing
View Details